SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008071 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008071
Domain Number 1 Region: 11-200
Classification Level Classification E-value
Superfamily E set domains 1.9e-78
Family RhoGDI-like 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008071   Gene: ENSPTRG00000004729   Transcript: ENSPTRT00000008734
Sequence length 201
Comment pep:known chromosome:CHIMP2.1.4:12:15224132:15243134:-1 gene:ENSPTRG00000004729 transcript:ENSPTRT00000008734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIV
SGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTD
DDKQDHLSWEWNLSIKKEWTE
Download sequence
Identical sequences A0A024RAS5 A0A2J8SQS3 G1QV75 G3R1T1 H2Q5I9 P52566
ENSGGOP00000009163 ENSP00000228945 ENSP00000440560 ENSP00000444860 gi|56676393|ref|NP_001166.3| ENSGGOP00000009163 ENSP00000228945 ENSP00000440560 ENSP00000444860 9598.ENSPTRP00000008071 9606.ENSP00000228945 NP_001166.3.87134 NP_001166.3.92137 NP_001308349.1.87134 NP_001308349.1.92137 NP_001308350.1.87134 NP_001308350.1.92137 NP_001308351.1.87134 NP_001308351.1.92137 NP_001308352.1.87134 NP_001308352.1.92137 XP_003265593.1.23891 XP_003265594.1.23891 XP_004052845.1.27298 XP_004092153.1.23891 XP_004092154.1.23891 XP_004092155.1.23891 XP_004092156.1.23891 XP_008967803.1.60992 XP_009423189.1.37143 XP_009423190.1.37143 XP_012357839.1.23891 ENSPTRP00000008071 ENSNLEP00000004845 ENSNLEP00000004845 ENSP00000228945 ENSPTRP00000008071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]