SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008279 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008279
Domain Number 1 Region: 258-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.55e-52
Family Reprolysin-like 0.00077
Further Details:      
 
Domain Number 2 Region: 556-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000301
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 1111-1170
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000746
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 1261-1322
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000366
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 963-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 1061-1113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 7 Region: 1210-1266
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 1562-1616
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 1327-1381
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000379
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 10 Region: 1376-1437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 851-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000471
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000008279
Domain Number - Region: 910-964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0157
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 1503-1545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.017
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008279   Gene: ENSPTRG00000004841   Transcript: ENSPTRT00000008963
Sequence length 1817
Comment pep:novel chromosome:CHIMP2.1.4:12:45862316:46064818:1 gene:ENSPTRG00000004841 transcript:ENSPTRT00000008963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVAKWLTGLLYHLSLFVTRSWEVHFHPRQEALVRTLTSYEVVIPERVNEFGEVFPQSHH
FSRQKRSSEALEPMPFRTHYRFTAYGQLFQLNLTADASFLAAGYTEVHLGTPERGAWESD
AGPSDLRHCFYRGQVNSQEDYKAVVSLCGGLTGTFKGQNGEYFLEPIMKADGNEYEDGHN
KPHLIYRQELNNSFLQTLKYCNVSESQIKETSLPFHTYSNMNEDLNVMKERVLGHTSKNV
PLKDERSQLHSRKKRLISYPRYIEIMVTADAKVVSAHGSNLQNYILTLMSIVATIYKDPS
IGNLIHIVVVKLVMIHCEEEGPVINFDGATTLKNFCSWQQTQNDLDDVHPSHHDTAVLIT
REDICSSKEKCNMLGLSYLGTICDPLQSCFINEEKGLISAFTIAHELGHTLGVQHDDSPR
CKEMKVTQYHVMAPALSFHMSPWSWSNCSRKYVTEFLDTGYMETLLDKPDEEIYNLPSEL
PGSRYDGNKQCELAFGPGSQMCPHINICMHLWCTSTEKLHKGCFTQHVPPADGTDCGPGM
HCRHGLCVNKETETRPVNGEWGPWEPYSSCSRTCGGGIESATRRCNRPEPRNGGNYCVGR
RMKFRSCNTDSCPKGTQDFREKQCSDFNGKHLDISGIPSNVRWLPRYSGIGTKDRCKLYC
QVAGTNYFYLLKDMVEDGTPCGTETHDICVQGQCMAAGCDHVLNSSAKIDKCGVCGGDNS
SCKTITGVFNSSHYGYNVVVKIPAGATNVDIRQYSYSGQPDDSYLALSDAEGNFLFNGNF
LLSTSKKEINVQGTRTVIEYSGSNNAVERINSTNRQEKELILQVLCVGNLYNPDVHYSFN
IPLEERSDMFTWDPYGPWEGCTKMCQGLQRRNITCIHKSDHSVVSDKECDHLPLPSFVTQ
SCNTDCELRWHVIGKSECSSQCGQGYRTLDIHCMKYSIHEGQTVQVDDHYCGDQLKPPTR
ELCHGNCVFTRWHYSEWSQCSRSCGGGERSRESYCMNNFGHRLADNECQELSRVTRENCN
EFSCPSWAASEWSESCVLTPCSFISKLETALLPTVLIKKMAQWRHGSWTPCSVSCGRGTQ
ARYVSCRDALDRIADESYCAHLPRPAEIWDCFTPCGEWQAGDWSPCSASCGHGKTTRQVL
CMNYHQPIDENYCDPEVRPLMEQECSLAACPTAHSHFPSSPVQPSYYLSTNLPLTHKLED
NENQVVHPSVRGNQWRTGPWGSCSSSCSGGLQRRAVVCQDENGQSASYCDAASKPPELQH
CGPGPCPQWNYGNWGECSQTCGGGIKSRLVICQFPNGQILEDHNCEIVNKPPSVIQCHMH
ACPADVSWHQEPWTSCSASCGKGRKYREVFCIDQFQRKLEDTNCSQVQKPPTHKACRSVR
CPSWKANSWNECSVTCGSGVQQRDVYCRLKGVGQVVEEMCDQSTRPCSQRRCWSQDCVQH
KGMERGRLNCSTSCERKDSHQRMECTDNQMRQVNEIVYNSSTISLTSKNCRNPPCNYIVV
TADSSQCANNCGFSYRQRITYCTEIPSTKKHKLHRLRPIVYQECPVVPSSQVYKCINSCL
HLATWKVGKWSKCSVTCGIGIMKRQVKCITKHGLSSDLCLNHLKPGAQKKCYANDCKSFT
TCKEIQVKNHIRKDGDYYLNIKGRIIKIYCADMYLENPKEYLTLVQGEENFSEVYGFRLK
NPYQCPFNGSRREDCECDNGHLAAGYTVFSKIRIDLTSMQIKTTDLLFSKTIFGNAVPFA
TAGDCYSAFRCPQGQFSINLSGTGMKISSTAKWLTQGSYTSVSIRRSEDGTRFFGKCGGY
CGKCLPHMATGLPIQVI
Download sequence
Identical sequences ENSPTRP00000008279 ENSPTRP00000008279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]