SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008515 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008515
Domain Number 1 Region: 151-237
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.27e-26
Family Thyroglobulin type-1 domain 0.00000428
Further Details:      
 
Domain Number 2 Region: 66-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008515   Gene: ENSPTRG00000005001   Transcript: ENSPTRT00000009210
Sequence length 241
Comment pep:known chromosome:CHIMP2.1.4:12:36168019:36172712:-1 gene:ENSPTRG00000005001 transcript:ENSPTRT00000009210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPHRLLPPLLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAE
AEGCLRREGQDCGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKE
SKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVY
RGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSS
G
Download sequence
Identical sequences H2Q612
ENSPTRP00000008515 9598.ENSPTRP00000008515 ENSPTRP00000008515 XP_003831086.1.60992 XP_509089.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]