SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008522 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008522
Domain Number 1 Region: 178-416
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.03e-102
Family Nuclear receptor ligand-binding domain 0.00000000777
Further Details:      
 
Domain Number 2 Region: 88-174
Classification Level Classification E-value
Superfamily ECOD 3.06e-58
Family ECOD 0.00013
Further Details:      
 
Domain Number 3 Region: 90-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.7e-56
Family Nuclear receptor 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008522   Gene: ENSPTRG00000005007   Transcript: ENSPTRT00000009219
Sequence length 454
Comment pep:known chromosome:CHIMP2.1.4:12:36034062:36055811:1 gene:ENSPTRG00000005007 transcript:ENSPTRT00000009219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Download sequence
Identical sequences A0A096MRJ1 A0A2J8SXA0 A0A2K5ESJ5 A0A2K5N2N6 A0A2K5XRB2 A0A2K6BU81 A8K3H3 G7N741 G7PHU3 H2Q616 P13631
ENSP00000377947 ENSP00000388510 IGBMC-0078-000 ENSMMUP00000016394 6fx0_A gi|4506423|ref|NP_000957.1| ENSP00000332695 9544.ENSMMUP00000028994 9598.ENSPTRP00000008522 9606.ENSP00000332695 ENSP00000388510 ENSPTRP00000008522 ENSMMUP00000028994 ENSPTRP00000008522 NP_000957.1.87134 NP_000957.1.92137 XP_003831072.1.60992 XP_008001592.1.81039 XP_008001593.1.81039 XP_008954669.1.60992 XP_011727137.1.29376 XP_011727138.1.29376 XP_011857082.1.47321 XP_011903497.1.92194 XP_011903498.1.92194 XP_011903499.1.92194 XP_012305732.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]