SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008798 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008798
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-57
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000008798
Domain Number - Region: 304-359
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00289
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008798   Gene: ENSPTRG00000005174   Transcript: ENSPTRT00000009511
Sequence length 729
Comment pep:known chromosome:CHIMP2.1.4:12:24766718:24816853:-1 gene:ENSPTRG00000005174 transcript:ENSPTRT00000009511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMVIHIFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADGWAHQE
GTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQ
KMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTVD
GGLRNVDCL
Download sequence
Identical sequences H2Q6E2
ENSPTRP00000008798 9598.ENSPTRP00000008798 XP_008976690.1.60992 XP_014202627.1.60992 XP_509194.2.37143 ENSPTRP00000008798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]