SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008814 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008814
Domain Number 1 Region: 151-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.48e-58
Family Protein kinases, catalytic subunit 0.00066
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily DEATH domain 1.75e-29
Family DEATH domain, DD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008814   Gene: ENSPTRG00000005187   Transcript: ENSPTRT00000009529
Sequence length 596
Comment pep:known chromosome:CHIMP2.1.4:12:22982534:23046240:-1 gene:ENSPTRG00000005187 transcript:ENSPTRT00000009529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANVTVDNVLIPEHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFRHPNILELAAYFTETEKFCLV
YPYMRNGTLFDRLQCVGDTAPLPWHIRISILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGWCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNMDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
Download sequence
Identical sequences K6ZTY6
ENSPTRP00000008814 ENSPTRP00000008814 9598.ENSPTRP00000008814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]