SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009043 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009043
Domain Number 1 Region: 186-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-94
Family Protein kinases, catalytic subunit 0.0000000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009043   Gene: ENSPTRG00000005323   Transcript: ENSPTRT00000009779
Sequence length 523
Comment pep:known chromosome:CHIMP2.1.4:12:96526969:96641793:-1 gene:ENSPTRG00000005323 transcript:ENSPTRT00000009779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQ
YTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEV
QSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRAS
LSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVS
LLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRG
LAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVL
LGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNE
EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRI
HALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
Download sequence
Identical sequences A0A024RBH0 A0A096MU99 A0A2K5JC65 A0A2K5KMN3 A0A2K5RET4 A0A2K5YBZ4 A0A2K6B6Q8 A0A2K6T4K9 F7ATI3 G3QFS5 G7PJ38 H2NIB8 H2Q6N5 Q00537 U3FCU9
ENSPPYP00000005536 ENSPPYP00000005536 ENSP00000261211 ENSPTRP00000009043 ENSP00000261211 ENSGGOP00000001155 ENSGGOP00000001155 NP_002586.2.87134 NP_002586.2.92137 XP_001147273.1.37143 XP_002752932.1.60252 XP_002823661.1.23681 XP_003832670.1.60992 XP_003929639.1.74449 XP_004053761.1.27298 XP_005571976.1.63531 XP_009002652.1.60252 XP_011742931.1.29376 XP_011789677.1.43180 XP_011888208.1.92194 XP_015007965.1.72884 XP_016874894.1.92137 XP_016874895.1.92137 XP_017371772.1.71028 ENSPTRP00000009043 ENSP00000261211 ENSMMUP00000020904 ENSMMUP00000020904 gi|37595545|ref|NP_002586.2| 9544.ENSMMUP00000020904 9598.ENSPTRP00000009043 9600.ENSPPYP00000005536 9606.ENSP00000261211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]