SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009088 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009088
Domain Number 1 Region: 245-471
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8e-64
Family Nuclear receptor ligand-binding domain 0.00000000077
Further Details:      
 
Domain Number 2 Region: 125-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009088   Gene: ENSPTRG00000005345   Transcript: ENSPTRT00000009829
Sequence length 472
Comment pep:known chromosome:CHIMP2.1.4:12:100772227:100862586:1 gene:ENSPTRG00000005345 transcript:ENSPTRT00000009829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGR
IKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQ
ECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQTMNEDSEGRDLRQVTSTTKSCR
EKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVE
FTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDE
YITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCK
IHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Download sequence
Identical sequences H2Q6P6
ENSPTRP00000009088 XP_003952320.1.37143 ENSPTRP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]