SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009272 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009272
Domain Number 1 Region: 82-399
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-59
Family Choline kinase 0.082
Further Details:      
 
Domain Number 2 Region: 475-735
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.82e-59
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00078
Further Details:      
 
Domain Number 3 Region: 721-875
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.26e-42
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00022
Further Details:      
 
Domain Number 4 Region: 3-74
Classification Level Classification E-value
Superfamily HAD-like 0.0000000000000208
Family YihX-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009272   Gene: ENSPTRG00000005462   Transcript: ENSPTRT00000010026
Sequence length 877
Comment pep:known chromosome:CHIMP2.1.4:12:112131415:112202259:1 gene:ENSPTRG00000005462 transcript:ENSPTRT00000010026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGICKPDPRIYKLCLERLGLQPSESIFLDDLGPNLKEAARLGIHTIKVNDPETAVKELE
ALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGPLELLQFDHGQSNPTYYI
RLANRDLVLRKKPPGTLLPSAHAIEREFRIMKALANAGVPVPNVLDLCEDSSVIGTPFYV
MEYCPGLIYKDPSLPGLEPSHRRAIYTAMNTVLCKIHSVDLQAVGLEDYGKQGDYIPRQV
RTWVKQYRASETSTIPAMERLIEWLPLHLPRQQRTTVVHGDFRLDNLVFHPEEPEVLAVL
DWELSTLGDPLADVAYSCLAHYLPSSFPVLRGINDCDLTQLGIPAAEEYFRMYCLQMGLP
PTENWNFYMAFSFFRVAAILQGVYKRSLTGQASSTYAEQTGKLTEFVSNLAWDFAVKEGF
RVFKEMPFTNPLTRSYHTWARPQSQWCPTGSRSYSSVPEASPAHTSRGGLVISPESLSPP
VRELYHRLKHFMEQRVYPAEPELQSHQASAARWSPSPLIEDLKEKAKAEGLWNLFLPLEA
DPEKKYGAGLTNMEYAHLCELMGTSLYAPEVCNCSAPDTGNMELLVRYGTEAQKARWLIP
LLEGKARSCFAMTEPQVASSDATNIEASIREEDSFYVINGHKWWITGILDPRCQLCVFMG
KTDPHALRHRQQSVLLVPMDTPGIKIIRPLTVYGLEDAPGGHGEVRFEHVRVPKENMVLG
PGRGFEIAQGRLGPGRIHHCMRLIGFSERALALMKARVKSRVAFGKPLVEQGTVLADIAQ
SRVEIEQARLLVLRAAHLMDLAGNKAAALDIAMIKMVAPSMASRVIDRAIQAFGAAGLSS
DYPLAQFFTWARALRFADGPDEVHRATVAKLELKHRI
Download sequence
Identical sequences ENSPTRP00000009272 ENSPTRP00000009272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]