SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009752 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009752
Domain Number 1 Region: 25-341
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-75
Family Protein kinases, catalytic subunit 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009752   Gene: ENSPTRG00000005724   Transcript: ENSPTRT00000010543
Sequence length 464
Comment pep:known chromosome:CHIMP2.1.4:13:25807163:25957961:1 gene:ENSPTRG00000005724 transcript:ENSPTRT00000010543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Download sequence
Identical sequences A0A091DST1 A0A096MXS9 A0A0D9RZG8 A0A2K5C2X2 A0A2K5INT8 A0A2K5L340 A0A2K5SI45 A0A2K6BRD3 A0A2K6R7R9 A0A2K6UGP7 G1RUX2 G1T9S5 G3QUM8 G7PVW1 H2NJG6 H2Q7B5 H9FNK1 I3MRT5 M3WW64 P49336 U3DXG6
ENSPPYP00000005956 ENSPANP00000004707 ENSNLEP00000017049 ENSOCUP00000013396 ENSNLEP00000017049 NP_001248269.1.72884 NP_001251.1.87134 NP_001251.1.92137 XP_002824149.1.23681 XP_003273187.1.23891 XP_003818394.1.60992 XP_003919781.1.74449 XP_003980313.1.62641 XP_004054332.1.27298 XP_004631098.1.9945 XP_004781534.1.14098 XP_005342097.1.77405 XP_005406401.1.28644 XP_005585576.1.63531 XP_008019965.1.81039 XP_008151587.1.99482 XP_008258109.1.1745 XP_008820556.1.79516 XP_010358488.1.97406 XP_010622120.1.5607 XP_011753937.1.29376 XP_011813912.1.43180 XP_011813921.1.43180 XP_011940229.1.92194 XP_012297136.1.9421 XP_012362150.1.23891 XP_012633986.1.48125 XP_014939238.1.86478 XP_015354181.1.40921 XP_017393018.1.71028 XP_019303465.1.44245 XP_509595.2.37143 ENSPTRP00000009752 ENSPPYP00000005956 gi|4502745|ref|NP_001251.1| HR3119 ENSP00000370938 ENSP00000370938 9598.ENSPTRP00000009752 9600.ENSPPYP00000005956 9606.ENSP00000370938 9986.ENSOCUP00000013396 ENSOCUP00000013396 ENSFCAP00000018601 ENSP00000370938 ENSPTRP00000009752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]