SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009773 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009773
Domain Number 1 Region: 576-717,769-944
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.64e-79
Family Protein kinases, catalytic subunit 0.0000000000392
Further Details:      
 
Domain Number 2 Region: 256-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000678
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000009773
Domain Number - Region: 81-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00134
Family I set domains 0.031
Further Details:      
 
Domain Number - Region: 485-572
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0229
Family Rhodopsin-like 0.05
Further Details:      
 
Domain Number - Region: 358-460
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0279
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009773   Gene: ENSPTRG00000005740   Transcript: ENSPTRT00000010564
Sequence length 996
Comment pep:known chromosome:CHIMP2.1.4:13:27595420:27692994:-1 gene:ENSPTRG00000005740 transcript:ENSPTRT00000010564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALARGGGRLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVISMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDPYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETMLLNSPGPFPFIQD
NISFYATIGVCLLFIVILTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNVRLARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDAN
FYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLADAEEAMYQN
VDGCVSECPHTYQNRRPFSREMDSGPLSPQAQVEDS
Download sequence
Identical sequences ENSPTRP00000009773 9598.ENSPTRP00000009773 ENSPTRP00000009773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]