SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009963 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009963
Domain Number 1 Region: 69-302
Classification Level Classification E-value
Superfamily L domain-like 3.51e-39
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 2 Region: 576-687
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-26
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009963   Gene: ENSPTRG00000005856   Transcript: ENSPTRT00000010765
Sequence length 726
Comment pep:known chromosome:CHIMP2.1.4:13:46241338:46430825:1 gene:ENSPTRG00000005856 transcript:ENSPTRT00000010765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGSKPQPFVPALTVATLHPLHHPHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLNRG
LERALEEAANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSL
EILNLYHNCIRVIPEAIVNLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPE
EIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNYLKVLPQELVDLPLVKFDFSC
NKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTADSLYL
HTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQIIK
EDSCHRLSPVKGEFHQEFQPESSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAEDCE
ELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNLYP
MGSAEALELQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEVRENSPAVSPTTNST
APFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHEDL
GAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRKLGVPEAD
LCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRSRDLIGFCLVHILFIVLVYITYH
WNALSA
Download sequence
Identical sequences ENSPTRP00000009963 ENSPTRP00000009963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]