SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010284 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010284
Domain Number 1 Region: 172-452
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.55e-80
Family Eukaryotic proteases 0.00000000532
Further Details:      
 
Domain Number 2 Region: 60-123
Classification Level Classification E-value
Superfamily GLA-domain 1.57e-24
Family GLA-domain 0.0000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010284   Gene: ENSPTRG00000006049   Transcript: ENSPTRT00000011112
Sequence length 466
Comment pep:known chromosome:CHIMP2.1.4:13:113849141:113863441:1 gene:ENSPTRG00000006049 transcript:ENSPTRT00000011112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSQALRLLCLLLGLQGCLAAGGVAEASGGETRDMPWKPGPHRVFITQEEAHGVLHRRRR
ANAFLEELRPGSLERECKEEQCSFEEAREIFKDLERTKLFWISYSDGDQCASSPCQNGGS
CKDQLQSYICFCLPAFEGRNCETYKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSL
LADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGG
TLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYIPGTTN
HDIALLRLHQPVVLTDHVVPLCLPERAFSERTLAFVRFSLVSGWGQLLDRGATALELMVL
NVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTG
IVSWGQGCASVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP
Download sequence
Identical sequences ENSPTRP00000010284 ENSPTRP00000010284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]