SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010306 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010306
Domain Number 1 Region: 190-448
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.15e-45
Family Protein kinases, catalytic subunit 0.0000386
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-35
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010306   Gene: ENSPTRG00000006064   Transcript: ENSPTRT00000011139
Sequence length 481
Comment pep:novel chromosome:CHIMP2.1.4:13:114413954:114431945:1 gene:ENSPTRG00000006064 transcript:ENSPTRT00000011139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGTVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIFMAPELLQGEEYDFSVDYFALGVTL
YEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFR
DETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTD
TEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLV
S
Download sequence
Identical sequences ENSPTRP00000010306 ENSPTRP00000010306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]