SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010577 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010577
Domain Number 1 Region: 586-851
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 423-541
Classification Level Classification E-value
Superfamily PH domain-like 3.1e-32
Family Pleckstrin-homology domain (PH domain) 0.0000118
Further Details:      
 
Domain Number 3 Region: 125-197
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.36e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 262-321
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.88e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010577   Gene: ENSPTRG00000006232   Transcript: ENSPTRT00000011432
Sequence length 912
Comment pep:known chromosome:CHIMP2.1.4:14:28435757:28794083:-1 gene:ENSPTRG00000006232 transcript:ENSPTRT00000011432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKTA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPAKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPPPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEQYAGEQGLQYPAHLINPSASHSDTPETEET
EMKALGERVSIL
Download sequence
Identical sequences K7BPN6
ENSPTRP00000010577 ENSPTRP00000010577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]