SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010750 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010750
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 228-370
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-24
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000248
Family First domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010750   Gene: ENSPTRG00000006340   Transcript: ENSPTRT00000011611
Sequence length 622
Comment pep:known chromosome:CHIMP2.1.4:14:50595227:50675895:1 gene:ENSPTRG00000006340 transcript:ENSPTRT00000011611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
RLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPE
AYFPSWVVSKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMD
QLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMC
IYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences K7CJQ2 Q96NE9
9598.ENSPTRP00000010750 ENSPTRP00000010750 HT47 ENSPTRP00000010750 ENSP00000348550 ENSP00000343899 ENSP00000343899 NP_001253975.1.87134 NP_001253975.1.92137 XP_003831767.1.60992 XP_006720092.1.92137 XP_008955322.1.60992 XP_008955324.1.60992 XP_008955326.1.60992 XP_008955327.1.60992 XP_011534725.1.92137 XP_011534726.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]