SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010911 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010911
Domain Number 1 Region: 262-498
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-63
Family Nuclear receptor ligand-binding domain 0.000000000589
Further Details:      
 
Domain Number 2 Region: 147-225
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010911   Gene: ENSPTRG00000006432   Transcript: ENSPTRT00000011781
Sequence length 530
Comment pep:known chromosome:CHIMP2.1.4:14:63309306:63359134:-1 gene:ENSPTRG00000006432 transcript:ENSPTRT00000011781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMAFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLAVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNHCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
Download sequence
Identical sequences H2Q8G2
9598.ENSPTRP00000010911 XP_016781705.1.37143 ENSPTRP00000010911 ENSPTRP00000010911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]