SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011015 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011015
Domain Number 1 Region: 106-386
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-78
Family Protein kinases, catalytic subunit 0.0000144
Further Details:      
 
Domain Number 2 Region: 50-116
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-20
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011015
Domain Number - Region: 405-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00259
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011015   Gene: ENSPTRG00000006499   Transcript: ENSPTRT00000011901
Sequence length 1101
Comment pep:known chromosome:CHIMP2.1.4:14:69936162:70017063:-1 gene:ENSPTRG00000006499 transcript:ENSPTRT00000011901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEVVEEEEAAAAAAGPGELGCDAPLPYWTA
VFEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPPPIQLL
EIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAM
LKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLH
DEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMA
PEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEP
FAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFHCLQDDWKHEIQEMFDQL
RAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNIIIHQLCQEKPR
VKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLINSRSSPPASPTIIP
RLRAIQLTPGESSKTWGRSSVVPKDEGEEEEKRAPKKKGRTWGPGTLGQKELASGDEGSP
QRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSLALPGFTSLMEMAL
LAASWVVPIDIEEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHDEPTP
VNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLLEAGKCQLLPLEEP
EPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSISEC
NSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSLTPTHVTL
TAPSQPSSHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLPD
PNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSPANS
SSTETPSNLDSCFASSSSTVEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDSTVPL
CRVELNTHRPAPYEIQQEFWS
Download sequence
Identical sequences ENSPTRP00000011015 ENSPTRP00000011015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]