SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011041 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011041
Domain Number 1 Region: 560-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.59e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 701-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.5e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 152-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-17
Family G proteins 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011041
Domain Number - Region: 24-117,421-470,604-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00408
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011041   Gene: ENSPTRG00000006508   Transcript: ENSPTRT00000011927
Sequence length 777
Comment pep:known chromosome:CHIMP2.1.4:14:72219604:72279023:-1 gene:ENSPTRG00000006508 transcript:ENSPTRT00000011927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHER
IRLKPGHVPYCDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTV
YNVSNLQESLEAEEMDEETKRKKMTEKVVSFLLVDENEEIQVTNEEDFIKKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASKAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGVGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGE
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNV
QLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL
Download sequence
Identical sequences ENSPTRP00000011041 9598.ENSPTRP00000011041 ENSPTRP00000011041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]