SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011183 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011183
Domain Number 1 Region: 325-361
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000445
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011183   Gene: ENSPTRG00000006583   Transcript: ENSPTRT00000012076
Sequence length 567
Comment pep:known chromosome:CHIMP2.1.4:14:76772879:76797365:-1 gene:ENSPTRG00000006583 transcript:ENSPTRT00000012076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALRDRPGLLLCVLLLAAARGLPVKKPRLRGPRPGSLTRLAEVSASPDPRPLKEEEEAP
LLPRTHLQAEPHQHGRWTVTEPAAMTPGNATPPRTPEVTPLRLELQKLPGLANTTLSTPN
PDTQASASPDPRPLREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRTQEVT
PLLLELQKLPELVHATLSTPNPDNQVTIKVVEDPQAEVSIDLLAEPSNPPPQDTLSWLPA
LWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEEIEGEDQEDKEEDEEEQALWFNGTTD
NWDQGWLAPRDWVFKDSVSYDYEPQKEWSPWSPCSGNCSTGKQQRSRPCGYGCTVTETRT
CDLPSCPGTEDKDTLGLPSEEWKLLAHNATDMHDQDVDSCEKWLNCKSDFLIKYLSQMMR
DLPSCPCAYPLEAMDSPVSLQDEHQGRSFRWRDASGPRERLDIYQPTARFCLRSMLSGES
STLAVQHCCYDEDSRLLTRGKGAGMPNLISTDFSPKLHFKFDTTPWILCKGDWSRLHAVL
PPNNGRACTDNPLEEEYLAQLQEAKEY
Download sequence
Identical sequences H2Q8P8
ENSPTRP00000011183 ENSPTRP00000011183 XP_003314479.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]