SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011290 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011290
Domain Number 1 Region: 11-362
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-90
Family Protein kinases, catalytic subunit 0.0000000000675
Further Details:      
 
Domain Number 2 Region: 394-668
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-82
Family Protein kinases, catalytic subunit 0.00000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011290   Gene: ENSPTRG00000006631   Transcript: ENSPTRT00000012188
Sequence length 767
Comment pep:known chromosome:CHIMP2.1.4:14:90402059:90532017:-1 gene:ENSPTRG00000006631 transcript:ENSPTRT00000012188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTT
EHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQ
IYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERAYSFCG
TIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSE
PPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPF
KPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQ
FHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVK
IISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKH
FSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPD
NQPLKTPCFTLHYAAPELLNQNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAV
EIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSS
NPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTET
RSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDSVA
Download sequence
Identical sequences G1S5E3
9598.ENSPTRP00000011290 ENSPTRP00000011290 ENSPTRP00000011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]