SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011431 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011431
Domain Number 1 Region: 31-340
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-52
Family Protein kinases, catalytic subunit 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011431   Gene: ENSPTRG00000006705   Transcript: ENSPTRT00000012345
Sequence length 396
Comment pep:known chromosome:CHIMP2.1.4:14:96434226:96518530:1 gene:ENSPTRG00000006705 transcript:ENSPTRT00000012345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
EIEESKEPGVEDVEWSNTQTEEAIQTRSRTRKRVQK
Download sequence
Identical sequences H2Q8W5
ENSPTRP00000011431 9598.ENSPTRP00000011431 XP_008956538.1.60992 XP_510157.1.37143 ENSPTRP00000011431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]