SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011835 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011835
Domain Number 1 Region: 381-443
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 
Domain Number 2 Region: 240-303
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 3 Region: 334-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011835
Domain Number - Region: 213-242
Classification Level Classification E-value
Superfamily PKD domain 0.0106
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011835   Gene: ENSPTRG00000006933   Transcript: ENSPTRT00000012784
Sequence length 529
Comment pep:known chromosome:CHIMP2.1.4:15:37747535:37761214:1 gene:ENSPTRG00000006933 transcript:ENSPTRT00000012784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPG
FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
PDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVV
AILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL
Download sequence
Identical sequences A0A2J8QDP4 O43278
9598.ENSPTRP00000011835 9606.ENSP00000342098 ENSP00000342098 gi|32313599|ref|NP_857593.1| ENSP00000342098 ENSPTRP00000011835 NP_857593.1.87134 NP_857593.1.92137 XP_006720720.1.92137 ENSP00000342098 ENSPTRP00000011835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]