SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011856 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011856
Domain Number 1 Region: 452-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-73
Family Protein kinases, catalytic subunit 0.00000104
Further Details:      
 
Domain Number 2 Region: 167-355
Classification Level Classification E-value
Superfamily Fibronectin type III 5.22e-29
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 3 Region: 49-137
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-16
Family V set domains (antibody variable domain-like) 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011856   Gene: ENSPTRG00000006951   Transcript: ENSPTRT00000012808
Sequence length 833
Comment pep:novel chromosome:CHIMP2.1.4:15:38476862:38498585:1 gene:ENSPTRG00000006951 transcript:ENSPTRT00000012808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPV
KLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVE
DGGETEISQPVWLTVEGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLS
SSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLR
VRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGP
YKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDHA
GQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHF
RAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQL
KQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLP
IPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLA
ARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWA
FGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRP
SFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGGDQPYSGAGDGSGM
GAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
Download sequence
Identical sequences 9598.ENSPTRP00000011856 ENSPTRP00000011856 ENSPTRP00000011856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]