SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011929 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011929
Domain Number 1 Region: 52-259
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-47
Family Protein kinases, catalytic subunit 0.0000619
Further Details:      
 
Domain Number 2 Region: 526-590
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.88e-19
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Domain Number 3 Region: 342-376
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000209
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011929
Domain Number - Region: 379-446
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000994
Family Intermediate filament protein, coiled coil region 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011929   Gene: ENSPTRG00000006982   Transcript: ENSPTRT00000012885
Sequence length 1649
Comment pep:novel chromosome:CHIMP2.1.4:15:39745732:39924378:-1 gene:ENSPTRG00000006982 transcript:ENSPTRT00000012885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVEKDWGWGLWRNLRCLGHAHQGKCCTEGGISSTTKTSSENGSCCFEKAARKDHVCRF
IGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHR
DIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRN
REMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLD
HISSLDYFTKPDYQMSIRVTQKSYKVSTSGPQAFNSLSYTSGPGACISSSSFSRMGSSSF
RGGLGAGYGGASGGITTVTVNQSLLSPLNLEVDPNIQAVRTQEEKQIKTLNNKFFSFIDK
VRFLEQQNKMLETKWSLVQQQKMARSNMDNMFESYINNLKWQLETLGQEKLKLEAELGNM
HGLVEDFRNKYEVEISKCTEMENEFVLIKEYVDEAYMNKMELESSLKGLTAKISFLRQLY
EEEIGSCSPKSRIHLWCCSWTTAASWTWTASSLRSRPEGFPGGCHADTEQHGELAIKDAN
AKLSELEAALQLASQDMARQLREYQELMNVKLALDIKIATYRKLLEGEESWLESGMQNMS
IHMKTTSSYAGGQSLAYGGLTSPGLSYGLGSSFGSGMGSSSFSHTSSSRAVVVKKIETRD
GKLVSESSDVLPDLRITATLLTSVFDNSIKTFGVIESDPFDWEKTGNDGSLTTTTTSTTP
QLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIPVGVSPDKLPGSLGHP
RPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSLGSPIRVRSEITQPDR
DIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSAGKESILPALLHKPCV
PAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNLSSCKQEIDSKEWVIV
DKEQDLQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQLGPWAENDNLKKETSG
VVLALSAEGPPTAASEQYTDRLELQPGAASQFIAATPTSLMEAQAEGPLTAITIPRPSVA
STQSTSGSFHCGQQPEKKDLQPMEPTVELYSPRENFSGLVVTEGEPPSGGSRTDLGLQID
HIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREFENLPGETEEKSILLESDNEDEKLSR
GQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEIS
SRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGE
LFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSSPVSAKEKLLQKKAYQ
PDLVKLLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVLTPFSRLTVDSHLSRS
AEDSFLSPIISQSRKSKIPRPVSWVNTDQVNSSTSSQFFPRPPPGKPPTRPGVEARLRRY
KVLGSSNSDSDLFSRLAQILQNGSQKPRSTTQCKSPGSPHNPKTPPKSPVVPRRSPSASP
RSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQQEHCKPSKNG
LKGSGSLHHHSASTKTPQGKSKPASKLSR
Download sequence
Identical sequences A0A2J8QE78
ENSPTRP00000011929 ENSPTRP00000011929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]