SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011978 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011978
Domain Number 1 Region: 203-345
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 100-205
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-32
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 18-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-22
Family First domain of FERM 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011978   Gene: ENSPTRG00000007008   Transcript: ENSPTRT00000012937
Sequence length 570
Comment pep:known chromosome:CHIMP2.1.4:15:40986769:41316247:-1 gene:ENSPTRG00000007008 transcript:ENSPTRT00000012937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQVSAAPPHLHHFYCHHLNLLEKDYFGI
RFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRD
LYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHK
TELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHF
IKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSS
QVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPR
LSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIA
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEVEALGGELR
ALCQGHSGPEEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPE
FEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences ENSPTRP00000011978 ENSGGOP00000016635 ENSPTRP00000011978 ENSGGOP00000016635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]