SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012238 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012238
Domain Number 1 Region: 40-328
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.92e-81
Family Protein kinases, catalytic subunit 0.0000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012238   Gene: ENSPTRG00000007157   Transcript: ENSPTRT00000013210
Sequence length 422
Comment pep:known chromosome:CHIMP2.1.4:15:61577645:61762724:-1 gene:ENSPTRG00000007157 transcript:ENSPTRT00000013210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR
HK
Download sequence
Identical sequences A0A024R5W3 A0A2K6E8J1 A0A2K6QLW1 H2NNG8 H9ENM1 K7BCK9 Q9HCP0
ENSPPYP00000007429 ENSNLEP00000015108 ENSPPYP00000007429 ENSP00000305777 ENSP00000305777 NP_071331.2.87134 NP_071331.2.92137 XP_003827999.1.60992 XP_005559835.1.63531 XP_008014497.1.81039 XP_009427270.1.37143 XP_010353781.1.97406 XP_011751252.1.29376 XP_014997946.1.72884 XP_018866074.1.27298 9598.ENSPTRP00000012237 9600.ENSPPYP00000007429 9606.ENSP00000305777 ENSP00000305777 ENSPTRP00000012238 ENSMMUP00000008741 gi|98986450|ref|NP_071331.2| ENSPTRP00000012238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]