SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012263 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012263
Domain Number 1 Region: 308-394
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000112
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 225-288
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000589
Family Pre-dockerin domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000012263
Domain Number - Region: 492-550
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00294
Family Carboxypeptidase regulatory domain 0.053
Further Details:      
 
Domain Number - Region: 51-173
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.00889
Family Vitelline membrane outer protein-I (VMO-I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012263   Gene: ENSPTRG00000007177   Transcript: ENSPTRT00000013235
Sequence length 1184
Comment pep:known chromosome:CHIMP2.1.4:15:62636247:62651738:-1 gene:ENSPTRG00000007177 transcript:ENSPTRT00000013235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWF
NIDYPGGKGDYERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRTCLAE
MVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFMLHGAVSLPGGAPASG
AAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKVKFAPIVLTMPKTSLKAATIK
AEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLLDPSLYKHESK
LVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKEC
TCQRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLT
FVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRRKEPITLEAMETNIIPLGEVVGEDPMAE
LEIPSRSFYRQNGEPYIGKVKASVTFLDPRNISTATAAQSDLNFINDEGDTFPLRTYGMF
SVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEEGDFKFENQR
RNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQIQGVVISVINL
EPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLR
ACEEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKI
VGPLEVNVRSRNMGGTHRRTVGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRV
DRTLVKVIPQGSCRRASVNPMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVT
DQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPAQS
PAAGTVQGRVPSRRQQRASRGGQRQSGVVASLRFPRVAQQPLIN
Download sequence
Identical sequences H2Q9M0
ENSPTRP00000012263 XP_016783858.1.37143 XP_510481.2.37143 9598.ENSPTRP00000012263 ENSPTRP00000012263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]