SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012333 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012333
Domain Number 1 Region: 154-425
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-73
Family Protein kinases, catalytic subunit 0.000000472
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.16e-57
Family PB1 domain 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012333   Gene: ENSPTRG00000007207   Transcript: ENSPTRT00000013308
Sequence length 448
Comment pep:known chromosome:CHIMP2.1.4:15:65032060:65298096:1 gene:ENSPTRG00000007207 transcript:ENSPTRT00000013308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNAAVVSMWVCRALEERRSQQGPP
Download sequence
Identical sequences A0A024R5Y2 A0A0D9RLR5 A0A2K6E1I2 G3QPY6 G7P8W8 H2NNK7 H2Q9P0 Q13163
hso002000965.1 ENSP00000178640 NP_660143.1.87134 NP_660143.1.92137 XP_001174814.1.37143 XP_002825634.2.23681 XP_003828056.1.60992 XP_004056426.1.27298 XP_008014322.1.81039 XP_011750074.1.29376 ENSPPYP00000007469 ENSPTRP00000012333 ENSPPYP00000007469 9598.ENSPTRP00000012333 9600.ENSPPYP00000007469 9606.ENSP00000178640 ENSPTRP00000012333 ENSP00000178640 ENSP00000178640 ENSGGOP00000004643 gi|21729895|ref|NP_660143.1| ENSGGOP00000004643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]