SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012380 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012380
Domain Number 1 Region: 114-410
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-64
Family Nuclear receptor ligand-binding domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 44-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.07e-29
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012380   Gene: ENSPTRG00000007242   Transcript: ENSPTRT00000013358
Sequence length 410
Comment pep:known chromosome:CHIMP2.1.4:15:69369213:69377636:1 gene:ENSPTRG00000007242 transcript:ENSPTRT00000013358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQTRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYG
IYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQN
ERQPRSTAQVRLDSMESNTEPRPESLVAPPAPAGPSPRGPTAMSAARALGHHFMASLITA
ETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPV
FSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMET
RVLRETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAH
HPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences A0A2I3SFZ5
ENSPTRP00000012380 ENSPTRP00000012380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]