SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012464 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012464
Domain Number 1 Region: 182-437
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-74
Family Protein kinases, catalytic subunit 0.000000000648
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 8.08e-35
Family SH2 domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 13-99
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012464   Gene: ENSPTRG00000007282   Transcript: ENSPTRT00000013447
Sequence length 441
Comment pep:known chromosome:CHIMP2.1.4:15:72364147:72368886:1 gene:ENSPTRG00000007282 transcript:ENSPTRT00000013447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGDVCEAMEYLEGNN
FVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDV
WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAM
RPSFLQLREQLEHIKTHELHL
Download sequence
Identical sequences ENSPTRP00000012464 9598.ENSPTRP00000012464 ENSPTRP00000012464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]