SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012566 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012566
Domain Number 1 Region: 239-441
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.97e-56
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 487-543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000314
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 771-830
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000012566
Domain Number - Region: 890-917
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000366
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Domain Number - Region: 830-863
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0301
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012566   Gene: ENSPTRG00000007350   Transcript: ENSPTRT00000013555
Sequence length 917
Comment pep:novel chromosome:CHIMP2.1.4:15:76401919:76446479:-1 gene:ENSPTRG00000007350 transcript:ENSPTRT00000013555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSY
ELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAH
IRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIQPLDSAPARPGHAQP
HVVYKRQAPERLAQRGDSSAPSTCGVQVYPELEPRRERWEQRQQWRRPRLRRLHQRSVSK
EKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLVLLEDE
EEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLS
HVAGMCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLL
YDAAPLTWSRCSRQYITRFLNVCHTLWCSVGTTCHSKLDAAVDGTRCGENKWCLNGECVP
VGFRPEAVDGGWSGWSAWSICSRSCGVGVQSAERQCTQPTPKYKGRYCVGERKRFRLCNL
QACPAGRPSFRHVQCSHFDAMLYKGQLHTWVPVVNDVNPCELHCRPANEYFAEKLRDAVV
DGTPCYQVRASRDLCINGICKNVGCDFEIDSGAMEDRCGVCHGNGSTCHTVSGTFEEAEG
LGYVDVGLIPAGAREIRIQEVAEAANFLALRSEDPEKYFLNGGWTIQWNGDYQVAGTTFT
YARRGNWENLTSPGPTKEPVWIQLLFQESNPGVHYEYTIHKEAGGHDEVPPPEFSWHYGP
WTKCTVTCGRGVQRESVYCSERQAGPVDEEHCDPLGRPDDCQRKCSQQPCPARWWAGEWQ
LCSSSCGPGGLSCQAVLCICSVGLDEQSALKPPACEHLPWPPTETPCNHHVPCPATAVGN
WSQCSVTYEEGTQHRNV
Download sequence
Identical sequences ENSPTRP00000012566 ENSPTRP00000012566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]