SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012631 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012631
Domain Number 1 Region: 22-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.54e-77
Family BAR domain 0.0000000701
Further Details:      
 
Domain Number 2 Region: 292-352
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012631   Gene: ENSPTRG00000007393   Transcript: ENSPTRT00000013622
Sequence length 355
Comment pep:known chromosome:CHIMP2.1.4:15:81057134:81184333:1 gene:ENSPTRG00000007393 transcript:ENSPTRT00000013622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGIFAGIICNQANRCLTWTSQQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILS
KTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGN
ALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKK
KRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEI
LQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVAKTTGSNIPMDQPCCRG
LYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences XP_008966473.1.60992 ENSPTRP00000012631 ENSPTRP00000012631 9598.ENSPTRP00000012631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]