SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012755 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012755
Domain Number 1 Region: 110-441
Classification Level Classification E-value
Superfamily Subtilisin-like 8.38e-98
Family Subtilases 0.00000000000495
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.4e-42
Family Proprotein convertase P-domain 0.00000035
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.89e-24
Family Prohormone convertase 1 pro-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 585-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000557
Family Growth factor receptor domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012755   Gene: ENSPTRG00000007461   Transcript: ENSPTRT00000013760
Sequence length 794
Comment pep:known chromosome:CHIMP2.1.4:15:88249381:88255893:1 gene:ENSPTRG00000007461 transcript:ENSPTRT00000013760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRPWLLWVVAATGTLVLLAADAHGQKVFTNTWAVHIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL
Download sequence
Identical sequences H2QA34
ENSPTRP00000012755 9598.ENSPTRP00000012755 ENSPTRP00000012755 XP_003807767.1.60992 XP_008958103.1.60992 XP_008958104.1.60992 XP_009428116.1.37143 XP_016782923.1.37143 XP_016782924.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]