SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012792 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012792
Domain Number 1 Region: 970-1264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-79
Family Protein kinases, catalytic subunit 0.0000000000945
Further Details:      
 
Domain Number 2 Region: 326-492
Classification Level Classification E-value
Superfamily L domain-like 9.36e-52
Family L domain 0.0000000548
Further Details:      
 
Domain Number 3 Region: 33-188
Classification Level Classification E-value
Superfamily L domain-like 2.84e-42
Family L domain 0.000000107
Further Details:      
 
Domain Number 4 Region: 488-607
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-31
Family Fibronectin type III 0.0000118
Further Details:      
 
Domain Number 5 Region: 783-925
Classification Level Classification E-value
Superfamily Fibronectin type III 1.72e-21
Family Fibronectin type III 0.0000893
Further Details:      
 
Domain Number 6 Region: 610-690,789-827
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-21
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 7 Region: 169-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-16
Family Growth factor receptor domain 0.0000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012792   Gene: ENSPTRG00000007489   Transcript: ENSPTRT00000013802
Sequence length 1364
Comment pep:known chromosome:CHIMP2.1.4:15:96156951:96470984:1 gene:ENSPTRG00000007489 transcript:ENSPTRT00000013802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASLPLPDRHSGH
KAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Download sequence
Identical sequences H2QA49
ENSPTRP00000012792 ENSPTRP00000012792 9598.ENSPTRP00000012792 XP_016782981.1.37143 XP_016782982.1.37143 XP_016782983.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]