SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012811 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012811
Domain Number 1 Region: 229-449
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.55e-51
Family Reprolysin-like 0.0035
Further Details:      
 
Domain Number 2 Region: 542-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000122
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 856-921
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 972-1028
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000929
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 924-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 802-861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000068
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012811   Gene: ENSPTRG00000007500   Transcript: ENSPTRT00000013823
Sequence length 1095
Comment pep:known chromosome:CHIMP2.1.4:15:97509029:97886049:-1 gene:ENSPTRG00000007500 transcript:ENSPTRT00000013823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGALLPPLVLPVLLLLVWGLDPGTAVGDAAADVEVVLPWRVRPDDVHLPPLPAAPGPR
RRRRPRTPPAAPRARPGERALLLHLPAFGRDLYLQLRRDLRFLSRGFEVEEAGAAGRRGR
PAELCFYSGRVLGHPGSLVSLSACGAAGGLVGLIQLGQEQVLIQPLNNSQGPFSGREHLI
RRKWSLTPSPSAEAQRPEQLCKFLTEKKKPTRGRPSRDWRERRNAIRLTSEHTVETLVVA
DADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKINIQVTKLVLLQQRPAKLSIGHHG
ERSLESFCHWQNEEYGGARYLGNNQVPGGKDDPPLVDAAVFVTRTDFCVHKDEPCDTVGI
AYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVKG
RNPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSQHTVRLPHKLPGMHYSANEQCQILF
GTNATFCRNMEHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPE
HVDGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKG
LPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCGP
YETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCQLVKGDFSHARGTALKDSGKG
SINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKLPLHLMVLLFHDQDYGIHYEY
TVPVNRTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVND
SDCPQASRPEPQVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVAT
RPLYCPGPRPATVQSCDGQDCLSIWEASEWSQCSASCGKGVRRRTVACTNSQGKCDASTR
PRAEEACEDYSGCYEWKTGDWSTCSSTCGKGLQSRVVQCMHKVTGRHGSECPALSKPAPY
RQCYQEVCNDRINANTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTC
RDFYANKMRQPLPSS
Download sequence
Identical sequences ENSPTRP00000012811 ENSPTRP00000012811 9598.ENSPTRP00000012811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]