SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012904 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000012904
Domain Number - Region: 178-247
Classification Level Classification E-value
Superfamily TIMP-like 0.0863
Family Tissue inhibitor of metalloproteinases, TIMP 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012904   Gene: ENSPTRG00000007557   Transcript: ENSPTRT00000013931
Sequence length 293
Comment pep:known chromosome:CHIMP2.1.4:16:709970:712279:1 gene:ENSPTRG00000007557 transcript:ENSPTRT00000013931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFPAAALLCALCCGLLAPAARAGYSEERCSWRGSGLTQEPGSVGQLALACAEGAVEWLY
PAGALRLTLGGPDPRARPGIACLRPVRPFAGAQVFAERAGGALELLLAEGPGPAGGRCVR
WGPRERRALFLQATPHRDISRRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAELL
LAACTSDFVIHGIIHGVAHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPL
RCGVRPGPGTFLFMGWSRFGEAWLGCAPRFQEFRRAYEAARAAHLHPCEVALH
Download sequence
Identical sequences A0A2I3RS73
ENSPTRP00000012904 XP_001156928.1.37143 ENSPTRP00000012904 9598.ENSPTRP00000012904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]