SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013439 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013439
Domain Number 1 Region: 78-329
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.65e-74
Family MHCK/EF2 kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 545-699
Classification Level Classification E-value
Superfamily HCP-like 0.00000000000741
Family HCP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013439   Gene: ENSPTRG00000007877   Transcript: ENSPTRT00000014508
Sequence length 725
Comment pep:known chromosome:CHIMP2.1.4:16:22313980:22391706:1 gene:ENSPTRG00000007877 transcript:ENSPTRT00000014508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEDLIFRLEGVDGSQSPRAGRDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNQKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDTGQNLSPDRCQDWVEALHWYNTALEMTDCDEGGEYDGMQ
NEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Download sequence
Identical sequences A0A2I3TJP1
ENSPTRP00000013439 XP_001161085.2.37143 XP_009428754.1.37143 XP_016784159.1.37143 ENSPTRP00000013439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]