SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013475 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013475
Domain Number 1 Region: 51-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-87
Family Protein kinases, catalytic subunit 0.0000153
Further Details:      
 
Domain Number 2 Region: 374-498
Classification Level Classification E-value
Superfamily Polo-box domain 9.68e-45
Family Polo-box duplicated region 0.000000545
Further Details:      
 
Domain Number 3 Region: 503-593
Classification Level Classification E-value
Superfamily Polo-box domain 1.44e-32
Family Polo-box duplicated region 0.00000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013475   Gene: ENSPTRG00000007892   Transcript: ENSPTRT00000014544
Sequence length 603
Comment pep:known chromosome:CHIMP2.1.4:16:23784340:23795841:1 gene:ENSPTRG00000007892 transcript:ENSPTRT00000014544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSTRKPLTVLNKGLENPLPERPREKEE
PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS
Download sequence
Identical sequences G2HFG8
9598.ENSPTRP00000013475 ENSPTRP00000013475 ENSPTRP00000013475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]