SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013476 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013476
Domain Number 1 Region: 568-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-54
Family Protein kinases, catalytic subunit 0.00054
Further Details:      
 
Domain Number 2 Region: 86-288
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000017
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013476   Gene: ENSPTRG00000007893   Transcript: ENSPTRT00000014545
Sequence length 974
Comment pep:known chromosome:CHIMP2.1.4:16:23795787:23818983:-1 gene:ENSPTRG00000007893 transcript:ENSPTRT00000014545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGIGEDSRLGLQAQPGAEPSPGRAGTERSPGGTQGPGQPCSCPGAMASAVRGSRPWP
RLGLQLQFAALLLGTLSPQVHTLRPENLLLVSTLDGSLHALSKQTGDLKWTLRDDPVIEG
PTYVTEMAFLSDPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSSDGVFYTGRKQDA
WFVVDPESGETQMTLTTEGPSTPRLYIGRTQYTVTMHDPRAPALRWNTTYRRYSAPPMDG
SPGKYMSHLASCGMGLLLTVDPGSGTVLWTQDLGVPVMGIYTWHQDGLRQLPHLTLARDT
LHFLALRWGHIRLPASGPQDTATLFSTLDTQLLMTLYVGKDETGFYVSKALVHTAVALVP
RGLTLAPADGPTTDEVTLQVSGEREGSPSTAVRYPSGSVALPSQWLLIGHHELPPVLHTT
MLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDSYLGLGPQD
LLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLASADSAHISQDAQSLHSGATRRSQK
RFQSPSKQAQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLR
ECFGLVRREVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRASLQEYVENPDLDRGGL
EPEVVLQQLMSGLAHLHSLHIVHRDLKPGNILITGPDSQGLGRVVLSDFGLCKKLPAGRC
SFSLHSGIPGTEGWMAPELLQLLPPDSPTSAVDIFSAGCVFYYVLSGGSHPFGDSLYRQA
NILTGAPCLAHLEEEVHDKVVARDLVGAMLSPLPQPRPSAPQVLAHPFFWSRAKQLQFFQ
DVSDWLEKESEQEPLVRALEAGGCAVVRDNWHKHISMPLQTDLRKFRSYKGTSVRDLLRA
VRNKKHHYRELPVEVRQALGQVPDGFVQYFTNRFPRLLLHTHRAMRSCASESLFLPYYPP
DSEARRPCPGAAGR
Download sequence
Identical sequences 9598.ENSPTRP00000013476 ENSPTRP00000013476 ENSPTRP00000013476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]