SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013693 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013693
Domain Number 1 Region: 17-316
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-85
Family Protein kinases, catalytic subunit 0.00000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013693   Gene: ENSPTRG00000008014   Transcript: ENSPTRT00000014784
Sequence length 406
Comment pep:known chromosome:CHIMP2.1.4:16:30892542:30901527:1 gene:ENSPTRG00000008014 transcript:ENSPTRT00000014784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRRLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
Download sequence
Identical sequences K7CF95
ENSPTRP00000013693 ENSPTRP00000013693 XP_003807523.1.60992 XP_008957864.1.60992 9598.ENSPTRP00000013693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]