SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014082 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014082
Domain Number 1 Region: 78-380
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-86
Family Protein kinases, catalytic subunit 0.000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014082   Gene: ENSPTRG00000008252   Transcript: ENSPTRT00000015206
Sequence length 424
Comment pep:known chromosome:CHIMP2.1.4:16:67193112:67212202:1 gene:ENSPTRG00000008252 transcript:ENSPTRT00000015206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAGFPAASQYAH
PCPGPPTAGHTEPPSEPPRRARVAKYRAKFDPRVTAKYDIKALIGRGSFSRVVRVEHRAT
RQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGEL
FDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKIIITDF
GLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDD
NRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWVVSMAA
SSSMKNLHRSISQNLLKRASSRCQSTKSAQSTRSSRSTRSNKSRRVRERELRELNLRYQQ
QYNG
Download sequence
Identical sequences H2QBD1 P11801
ENSP00000291041 ENSP00000291041 ENSPTRP00000014082 NP_006733.1.87134 NP_006733.1.92137 XP_003812216.1.60992 XP_016784373.1.37143 ENSPTRP00000014082 9598.ENSPTRP00000014082 9606.ENSP00000291041 ENSP00000291041 gi|27901803|ref|NP_006733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]