SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014256 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014256
Domain Number 1 Region: 213-466
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.76e-50
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014256   Gene: ENSPTRG00000008349   Transcript: ENSPTRT00000015395
Sequence length 471
Comment pep:known chromosome:CHIMP2.1.4:16:74062493:74088636:-1 gene:ENSPTRG00000008349 transcript:ENSPTRT00000015395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ
RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL
PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI
AIVRQTFNNEIKTMKKFESPNILRIFGICIDETVTPPQFSVVMEYCELGTLRELLDREKD
LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRETQTSMS
LGTTREKTDKVKSTAYLSPQELEDVFYLYDVKSEIYSFGIVLWEIATGDIPFQGCNSEEI
RKLVSVEREQEPLGEDCPSELREIIDQCRAHDPSLRPSVDEILKKLSTFSK
Download sequence
Identical sequences H2QBI3
ENSPTRP00000014256 XP_008953137.1.60992 XP_016785654.1.37143 XP_016785655.1.37143 9598.ENSPTRP00000014256 ENSPTRP00000014256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]