SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014280 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014280
Domain Number 1 Region: 250-602
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.87e-115
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000198
Further Details:      
 
Domain Number 2 Region: 99-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-38
Family Anticodon-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014280   Gene: ENSPTRG00000008364   Transcript: ENSPTRT00000015420
Sequence length 625
Comment pep:known chromosome:CHIMP2.1.4:16:75048655:75065367:-1 gene:ENSPTRG00000008364 transcript:ENSPTRT00000015420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTQAAVRLVRGSLRKTSWAEWGHRELRLGQLAPFTAPHKDKSFSDQRSELKRRLKAEKK
VAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGE
DPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGV
KLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHM
LPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMN
IIPGGAVAKPFITYHNELDMNLYMRVAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHN
PEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFR
RINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFL
EVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLF
EEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPA
MKPEDKKENVATTDTLESTTVGTSV
Download sequence
Identical sequences H2QBJ3
ENSPTRP00000014280 9598.ENSPTRP00000014280 XP_003315273.1.37143 XP_009429550.1.37143 ENSPTRP00000014280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]