SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014297 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014297
Domain Number 1 Region: 294-496
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.85e-54
Family Reprolysin-like 0.00026
Further Details:      
 
Domain Number 2 Region: 586-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.07e-16
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1124-1177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000628
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 930-991
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 994-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 1054-1115
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000824
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000014297
Domain Number - Region: 883-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014297   Gene: ENSPTRG00000008372   Transcript: ENSPTRT00000015440
Sequence length 1221
Comment pep:known chromosome:CHIMP2.1.4:16:76730024:76888824:-1 gene:ENSPTRG00000008372 transcript:ENSPTRT00000015440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECALLLAYALPAAGSGPPRGLAGLGRVAKALQLCCLCCASVAAALASDSSSGASGLNDD
YVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSS
HFIVQVLGKDGASETQKPEVQQCFYQGFVRNDSSSSLAVSTCAGLSGLIRTRKNEFLISP
LPQLLAQEHNYSSPAGHHPHVLYKRTAEEKIQRYRGYPGSGRNYPGYSPSHIPHASQSRE
TEYHHRRLQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLSVETLVV
ADKKMVEKHGKGNVTTYILTVMNMVSGLFKDGTIGSDINVVVVSLILLEQEPGGLLINHH
ADQSLNSFCQWQSALIGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYRSC
TINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFSWSSCSRQ
YLKKFLSTPQAGCLVDEPKQAGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCSLGFVKDI
CKSLWCHRVGHRCETKFMPAAEGTVCGLSMWCRQGQCVKFGELGPRPIHGQWSAWSKWSE
CSRTCGGGVKFQERHCNNPKPQYGGKFCPGSSRIYQLCNINPCNENSLDFRAQQCAEYNS
KPFRGWFYQWKPYTKVEEEDRCKLYCKAENFEFFFAMSGKVKDGTPCSPNKNDVCIDGVC
ELVGCDHELGSKAVSDACGVCKGDNSTCKFYKGLYLNQHKANEYYPVVIIPAGARSIEIQ
ELQVSSSYLAVRSLSQKYYLTGGWSIDWPGEFPFAGTTFEYQRSFNRPERLYAPGPTNET
LVFEILMQGKNPGIAWKYALPKVMNGTPPATKRPAYAWSIVQSECSVSCGGGYINVKAIC
LRDQNTQVNSSFCSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKSCAGGQQSRKIQCVQ
KKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPEWSLGPWSQCSKTCGRGVRKRELLCKG
SAAETLPESQCTSLPRPELQEGCVLGRCPKNNRLQWVASSWSECSATCGLGVRKREMKCS
EKGFQGKLITFPERRCRNIKKPNLDLEETCNRRACPAHPVYNVVAGWYSSPWQQCTVTCG
GGVQTRSVHCVQQGRPSSSCLLHQKPPVLRACNTNFCPAPEKREDPSCVDFFNWCHLVPQ
HGVCNHKFYGKQCCKSCTRKI
Download sequence
Identical sequences A0A2J8Q649
ENSPTRP00000014297 9598.ENSPTRP00000014297 ENSPTRP00000014297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]