SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014550 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000014550
Domain Number - Region: 206-357
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00151
Family Growth factor receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014550   Gene: ENSPTRG00000008529   Transcript: ENSPTRT00000015727
Sequence length 565
Comment pep:known chromosome:CHIMP2.1.4:17:1574536:1600571:-1 gene:ENSPTRG00000008529 transcript:ENSPTRT00000015727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGLLLPLLLLWTRGTQGSELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGP
DACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQC
QADRWGARCEFPCACGPHGRGPATGVCLCEPGWWSYTCRRPCQCNSAAAREQATGACVCK
PGWWGRLCSFRCNSHNCPCEQVSRRCARSCGHCKHNEPCSPDTGSCESCEPGWNGTQCQQ
PCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTC
PTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPG
SGSRDTALIVGSLVPLLLLFLGLACCACCCWAPRSDLKDMVPVVQAGSSEASLAAGAFPP
PEDASTPFAIPRTSSLARAKRPSVSFAEGTKFAPQSRRSSGELSSPLRKPKRLSRGAQSG
PEGRDAEESAGPEEAEAPESFPAAASPGDSATGHRRPPLGGRTVAEHVEAIEGSVQESSG
PVTTIYMLAGKPRGSEGPVRSVFRH
Download sequence
Identical sequences ENSPTRP00000014550 ENSPTRP00000014550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]