SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014677 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014677
Domain Number 1 Region: 335-456
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.99e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014677   Gene: ENSPTRG00000008595   Transcript: ENSPTRT00000015862
Sequence length 459
Comment pep:known chromosome:CHIMP2.1.4:17:4604697:4631124:1 gene:ENSPTRG00000008595 transcript:ENSPTRT00000015862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAPDAQEARTVREALGRYEAALEGAVRALHEDMQVLQRGVERRVAESMLLTGHLARTV
AHVQRYPHRQQAQPEDLPHPEGEGSASQKCXVPGTPGTPSPPAPGVPERAPRLGSARFAS
HATFSLSGRGQSLDHNEASESEMRKTSNSCIMENGHQPGAGPGDGPPEIAQNFSAPDAPR
PRPVSLSLRLPHQPVTAITRVSDRFSGETSAAALSPMSAATLGGLNPSPSEVITPWTPSP
SEKNSSFTRSVPSSGYGAVTASKHSSSPPLVTPPQSPVSPQPPAVTQVHRQGERRRELVR
SQTLPRTSEAQARKALFEKWEQETAAGKGKGEARARLKRSQSFGVASASSIKQILLEWCR
SKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTVAENL
ANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences ENSPTRP00000014677 ENSPTRP00000014677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]