SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015133 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015133
Domain Number 1 Region: 48-356
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.72e-96
Family Protein kinases, catalytic subunit 0.0000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015133   Gene: ENSPTRG00000008867   Transcript: ENSPTRT00000016351
Sequence length 814
Comment pep:known chromosome:CHIMP2.1.4:17:36621007:36625535:-1 gene:ENSPTRG00000008867 transcript:ENSPTRT00000016351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGAAPDTIDLTRSHLRIXXXXXXXXXXXXXXXXXXLKAA
LLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERERKE
RGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPAPTSVPAPAPAPTPTPTPVQP
TSPLPGPVAQPTGPQPQPAGSTSGPVPQPACPPLGPAPHPTGPPGPIPVPVPPQIATSTS
LLAAQSLVPPPGLPGSSTPGILPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Download sequence
Identical sequences ENSPTRP00000015133 ENSPTRP00000015133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]