SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015390 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015390
Domain Number 1 Region: 24-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.36e-29
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 
Domain Number 2 Region: 205-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.22e-26
Family GAS2 domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015390   Gene: ENSPTRG00000009023   Transcript: ENSPTRT00000016626
Sequence length 880
Comment pep:known chromosome:CHIMP2.1.4:17:21204174:21212519:1 gene:ENSPTRG00000009023 transcript:ENSPTRT00000016626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPAGGRRKPRTLGPPVCSIRPFKSSEQYLEAMKEDLAEWLRDLYGLDIDAANFLQVLE
TGLVLCRHANVVTDAALAFLAEAPAQAQKIPMPQVGVSYNGAAQPGTFQARDNVSNFIQW
CRKEMGIQEVLMFETEDLVLRKNVKNVVLCLLELGRRAWRFGVAAPTLVQLEEEIEEEVR
RELALPPPDPSPPAPPRRQPCHFRNLDQMVQNLVSHCTCPVQFSMVKVSEGKYRVGDSNT
LIFIRILRNHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHKPGSFLKPPAPPVQHEVRVQD
GPSQTQPTMTISRSQSPPPPVDWKTYTSSDRRLRPPTPSSPRPRRERGAGTGASREMAPF
LRCQERSLIPSWRQPTAGDSPPSPQSSSTQKGRDPQYTLSGKREERYPPELPRGRISTSW
VHEETDSWGTDAGNPTPQRLRAIEATTKGISARGPSPLPRSFGPAECLGLRLPLRDEAKG
AFFQFREPESVRSPTPVQGLTKIPIRLPPARPPTPGRSFPGATSGSPRTELGRDPIPLRA
VTVDLAGSTHGDCSVEVRQEDQQLDIQVMAEARESWDLGPQEHEGRYTPLPLGRNKEQAI
YCSLEEEILGNMKLLEVRSACPQGTRSGVIPRSGVYIPRLVGQWPEPGGPYDKVIQELAQ
GPPSLLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVP
PQGGQDCSASTVSASPEAPTPSPLDPNSDKAKVCLSKGRRTLRKPKRVPSIYKLKLRPRI
RPRRDHRPEKQPSRIPKPLAYVFLGPARQPPKDRLLRAVLGSKGGEASRVDGASVGEEEE
EGKEEKEPAAPLESSPQPPEGLQPHWLNQAPLPPEEESWV
Download sequence
Identical sequences A0A2I3SIQ4
9598.ENSPTRP00000015390 ENSPTRP00000015390 XP_001174066.1.37143 ENSPTRP00000015390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]