SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015450 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000015450
Domain Number - Region: 281-373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0596
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015450   Gene: ENSPTRG00000009067   Transcript: ENSPTRT00000016700
Sequence length 2365
Comment pep:known chromosome:CHIMP2.1.4:17:19057268:19076031:1 gene:ENSPTRG00000009067 transcript:ENSPTRT00000016700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRGAVMPPPIWGLLGCCFVCGWALGGPRPIRSLPPLSSQVKPGSVPMQVPLEGAEAAL
AYLYSGDAQQLSQVNCSERYEARGAGAMPGLPPSLQGAAGTLAQAANFLNMLLQANDIRE
SSVEEDVEWYQALVRSVAEGDPRVYRALLTFNPPPGASHLQLALQATRTGEETILQDLSG
NWVQEENPPGDLDTPALKKRVLTNDLGSLGSPKWPQADGYVGDTQQVRLSPPFLECQEGR
LRPGWLITLSATFYGLKPDLSPEVRGQVQMDVDLQSVDINQCASGPGWYSNTHLCDLNST
QCVPLESQGFVLGRYLCRCRPGFYGASPSGGLEESDFQTTGQFGFPEGRSGRLLQCLPCP
EGCTSCMDATPCLVEEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLE
TVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQ
RSALLSSGRLLRRLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHFYLCHHD
RWDYIMVVAELLLLCWGSFLCYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVP
SLHPDWTLLLFFFHTHSTVTTTLALIFIPKFWKLGAPPREEMVDEVCEGELDLQHSGSYL
GSSIASAWSERSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRGSSCQGLGRSFM
RYLAEFPEALARQHSRDSGSPGHGSLPGSSRRRLLSSSLQEPEGTPALRKSRSTYDQRRE
QDPPLLDSLLRRKLAKKASRTESRESVEGPPALGFRSASAHNLTVGERLPRARPASLQKS
LSVASSREKALLMASQAYLEETYRQAKEREERKKAKAAMASLVRRPSARRLERPRGAPLS
APPSPAKSSSMDSSHTSGRLHEEARRRLPHPPIRHQVSTPILALSGGLGEPRMLSPTSTL
APALLPALAPTPAPALAPVPVSPQSPNLLTYICPWENAELPAKQENVPQEGPSGPERGHH
SPAPARARLWRALSVAVEKSRAGENEMDAEDAHHQREANDVDEDRPKIFPKSHSLKAPVQ
QGSMRSLGLAIKALTRSRSTYREKESVEESPEGQNSGTVGESTGAPSRSPRLGRPKAVSK
QAALMPSDDEESLQNQQNAHTSRMLQVCQREGSREQDRGRRMTQGLGERKAERAGKTGLA
MLRQVSRDKNIEQSKETPVGWQELPKAGLQSLGSADHRVAEVCPWEVTESETRQPDSGNK
AEICPWETSEGAPESRALRQDPGDSQKKRGEARGKSEPIDVVPMMWKKPERLVREQEAVC
PWESADQGGLSPGSAPQDPGRIRDKSEAGDSVEARKVEKPGWEAAGPEAHTPDITKAEPC
PWEASEGGEDGKPAQEAVKDLPQEKQKTRKATFWKEQKPGGDLESLCPWESTDFRGPSAV
SIQAPGSSECSGSLGSGIAEVCPWEAGDAPAIQKAEICPWELDDNVMGQEMLSLGTGRES
LQEKEKASRKGSFGEMGEQTVKAVQKLSQQQESVCPRESTVPGHSSPCLDNSSSKAGSQF
LCNGGSRATQVCPQEDLRPEAQEATPAKTEICPWEVNERTREEWTSAQVPRGGESQKDKE
KMPGKSEIEDVTAWEKPEGQIQKQEAVGPWESVDPGSFSPQPHPQDTERPQTLLQMSGSV
GSKAADICPLDVEENLTAGKAAICPWEVGAGAGEERALGAEAIRKSPNDTGKASADLGPR
ERAVTAPEKPQKPTPEWEVACPWGSVGPGACSQHPGTLDADGPKAGFQELDHMGCRPGEV
CPWEAQEAATSEKAKICPWEVNEGTTGKGLDQKAGSESAEQREKVVEKGRLTSLREDVSK
GMAKLCQEQETICIWENKDLRESPAHAPKISDLPSSMSSEVAEGHSLEATEKGDLRQDPK
TGSFPEHITQEKAPAADTEEFTTEDGEKTSHELQSVCPWETTAPAVSVSHLDRQRPDQPK
ASSQRLVRTGGRAADVCPWDVPDAGVYKSDSSAKAETCPWEVTERIPVKGVSRQDGKGDS
QEEKGRAPEKSEPKGVPVQKKPEMADFRQEAVCPWESQDGKGLSPQPAPDASDRSRGSSE
AAGSVETRVAEVCLWEVVEAPSAKKAEICPWEAGGGAAEEGEQERESQGQGEMFLQKAGP
GGTEEHFSKAAAKPREQEAVCPGEGTGSGGLLPQSGALDPELKVSPEEAGSMGSRMAELC
QWEITDPEGNKIKGTMADICPGEETGVPSEESGLLALTATRREFFPTAPEKPLCLLVHGP
LDHFFPESKIPCPKVSRPASTFTLEGVRELQGPSGLEPRTSLAPEPSLQEAESQSSSLTE
DSGQVAFEAQYEEFTPPTVYPWDWE
Download sequence
Identical sequences H2QCS6
ENSPTRP00000015450 ENSPTRP00000015450 XP_511435.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]